Home > other
other
Hit optimization studies of 3-hydroxy-indolin-2-one analogs as potential anti-HIV-1 agents by unknow
pdf | | 2018-06-12 | Author:unknow

( Category: other February 1,2026 )
Rational identification of natural organic compounds to target the intermolecular interaction between Foxm and DNA in colorectal cancer by Chunling Dong & Peng Yan & Juxun Wang & Hailian Mu & Shuli Wang & Fangchun Guo
pdf | | 2017-03-14 | Author:Chunling Dong & Peng Yan & Juxun Wang & Hailian Mu & Shuli Wang & Fangchun Guo

( Category: other February 1,2026 )
New thiazol-hydrazono-coumarin hybrids targeting human cervical cancer cells_ Synthesis, CDK2 inhibition, QSAR and molecular docking studies by Somaia S. Abd El-Karim & Yasmin M. Syam & Ahmed M. El Kerdawy & Tamer M. Abdelghany
pdf | | 2019-05-06 | Author:Somaia S. Abd El-Karim & Yasmin M. Syam & Ahmed M. El Kerdawy & Tamer M. Abdelghany

( Category: other February 1,2026 )
Improvement of carbonyl reductase activity for the bioproduction of tert-butyl (3R,5S)-6-chloro-3,5-dihydroxyhexanoate by Zhi-Qiang Liu & Huan-Huan Yin & Xiao-Jian Zhang & Rong Zhou & Yan-Mei Wang & Yu-Guo Zheng
pdf | | 2018-08-16 | Author:Zhi-Qiang Liu & Huan-Huan Yin & Xiao-Jian Zhang & Rong Zhou & Yan-Mei Wang & Yu-Guo Zheng

( Category: other February 1,2026 )
mRNA incorporation of C(5)-halogenated pyrimidine ribonucleotides and induced high expression of corresponding protein for the development of mRNA vaccine by Chabungbam Dhurbachandra Singh
pdf | | | Author:Chabungbam Dhurbachandra Singh

( Category: other February 1,2026 )
Design, structure–activity relationships, and enzyme kinetic studies of tricyclic and tetracyclic coumarin–based sulfamates as steroid sulfatase inhibitors by unknow
pdf | | 2023-07-03 | Author:unknow

( Category: other February 1,2026 )
Synthesis and in vitro evaluation of chlorogenic acid amides as potential hypoglycemic agents and their synergistic effect with acarbose by Nunzio Cardullo & Giuseppe Floresta & Antonio Rescifina & Vera Muccilli & Corrado Tringali
pdf | | 2021-11-19 | Author:Nunzio Cardullo & Giuseppe Floresta & Antonio Rescifina & Vera Muccilli & Corrado Tringali

( Category: other February 1,2026 )
Rational design of new quinoline-benzimidazole scaffold bearing piperazine acetamide derivatives as antidiabetic agents by unknow
pdf | | 2024-11-28 | Author:unknow

( Category: other February 1,2026 )
Design, synthesis and structure-activity relationship optimization of phenanthridine derivatives as new Wntβ-catenin signalling pathway agonists by unknow
pdf | | 2019-02-08 | Author:unknow

( Category: other February 1,2026 )
Discovery of Thai mangrove tetranortriterpenoids as agonists of human pregnane–X–receptor and inhibitors against human carboxylesterase 2 by Yan-Xia Ren & Xiao-Peng Zou & Wan-Shan Li & Jun Wu & Li Shen
pdf | | 2021-02-02 | Author:Yan-Xia Ren & Xiao-Peng Zou & Wan-Shan Li & Jun Wu & Li Shen

( Category: other February 1,2026 )
Synthesis, in-vitro, in-vivo anti-inflammatory activities and molecular docking studies of acyl and salicylic acid hydrazide derivatives by unknow
pdf | | 2020-10-29 | Author:unknow

( Category: other February 1,2026 )
1,4-Dihydroquinazolin-3(2H)-yl benzamide derivatives as anti-inflammatory and analgesic agents with an improved gastric profile_ Design, synthesis, COX-12 inhibitory activity and m by Asmaa Sakr & Hend Kothayer & Samy M. Ibrahim & Mohamed M. Baraka & Samar Rezq
pdf | | 2019-02-08 | Author:Asmaa Sakr & Hend Kothayer & Samy M. Ibrahim & Mohamed M. Baraka & Samar Rezq

( Category: other February 1,2026 )
Euphorfistrines A-G, cytotoxic and AChE inhibiting triterpenoids from the roots of Euphorbia fischeriana by unknow
pdf | | 2021-10-14 | Author:unknow

( Category: other February 1,2026 )
Recent updates on development of protein-tyrosine phosphatase 1B inhibitors for treatment of diabetes, obesity and related disorders by unknow
pdf | | 2022-03-09 | Author:unknow

( Category: other February 1,2026 )
Synthesis of novel calcium channel blockers with ACE2 inhibition and dual antihypertensiveanti-inflammatory effects: A possible therapeutic tool for COVID-19 by unknow
pdf | | 2021-10-14 | Author:unknow

( Category: other February 1,2026 )

First Prev [395] [396] [397] [398] 399 [400] [401] [402] [403] [404] [405] Next Last
Categories
Popular ebooks
Whisky: Malt Whiskies of Scotland (Collins Little Books) by dominic roskrow(74009)
What's Done in Darkness by Kayla Perrin(27017)
The Ultimate Python Exercise Book: 700 Practical Exercises for Beginners with Quiz Questions by Copy(20917)
De Souza H. Master the Age of Artificial Intelligences. The Basic Guide...2024 by Unknown(20673)
D:\Jan\FTP\HOL\Work\Alien Breed - Tower Assault CD32 Alien Breed II - The Horror Continues Manual 1.jpg by PDFCreator(20563)
The Fifty Shades Trilogy & Grey by E L James(19523)
Shot Through the Heart: DI Grace Fisher 2 by Isabelle Grey(19415)
Shot Through the Heart by Mercy Celeste(19274)
Wolf & Parchment: New Theory Spice & Wolf, Vol. 10 by Isuna Hasekura and Jyuu Ayakura(17424)
Python GUI Applications using PyQt5 : The hands-on guide to build apps with Python by Verdugo Leire(17407)
Peren F. Statistics for Business and Economics...Essential Formulas 3ed 2025 by Unknown(17243)
Wolf & Parchment: New Theory Spice & Wolf, Vol. 03 by Isuna Hasekura and Jyuu Ayakura & Jyuu Ayakura(17141)
Wolf & Parchment: New Theory Spice & Wolf, Vol. 01 by Isuna Hasekura and Jyuu Ayakura & Jyuu Ayakura(16754)
The Subtle Art of Not Giving a F*ck by Mark Manson(14993)
The 3rd Cycle of the Betrayed Series Collection: Extremely Controversial Historical Thrillers (Betrayed Series Boxed set) by McCray Carolyn(14483)
Stepbrother Stories 2 - 21 Taboo Story Collection (Brother Sister Stepbrother Stepsister Taboo Pseudo Incest Family Virgin Creampie Pregnant Forced Pregnancy Breeding) by Roxi Harding(14321)
Cozy crochet hats: 7 Stylish and Beginner-Friendly Patterns from Baby Beanies to Trendy Bucket Hats by Vanilla Lazy(13567)
Scorched Earth by Nick Kyme(13143)
Reichel W. Numerical methods for Electrical Engineering, Meteorology,...2022 by Unknown(13015)
Drei Generationen auf dem Jakobsweg by Stein Pia(11307)