Synthesis of novel calcium channel blockers with ACE2 inhibition and dual antihypertensiveanti-inflammatory effects: A possible therapeutic tool for COVID-19 by unknow

Synthesis of novel calcium channel blockers with ACE2 inhibition and dual antihypertensiveanti-inflammatory effects: A possible therapeutic tool for COVID-19 by unknow

Author:unknow
Format: pdf
Tags: Bioisosters, CCB, ACE2 receptor, COVID-19, THP‐1 cells, Anti-inflammatory
Publisher: Elsevier Inc.
Published: 2021-10-14T19:34:13+00:00


Download



Copyright Disclaimer:
This site does not store any files on its server. We only index and link to content provided by other sites. Please contact the content providers to delete copyright contents if any and email us, we'll remove relevant links or contents immediately.
Popular ebooks
Eco-friendly approach of bio-indigo synthesis and developing purification methods towards isolation of indigo from indirubin and bacterial fragments by Ramalingam Manivannan & Kaliyan Prabakaran & Young-A Son(214044)
Personalized inhaled bacteriophage therapy for treatment of multidrug-resistant Pseudomonas aeruginosa in cystic fibrosis by unknow(182531)
CONSORT 2025 statement: updated guideline for reporting randomized trials by unknow(90896)
Critical evaluation of the ProfiLER-02 study design and outcomes by Vivek Subbiah & Razelle Kurzrock(90485)
Cardiac gene therapy makes a comeback by Oliver J. Müller & Susanne Hille & Anca Kliesow Remes(90246)
Whisky: Malt Whiskies of Scotland (Collins Little Books) by dominic roskrow(74461)
Unveiling the design rules for tunable emission in graphene quantum dots: A high-throughput TDDFT and machine learning perspective by Şener Özönder & Mustafa Coşkun Özdemir & Caner Ünlü(50911)
A yeast-based oral therapeutic delivers immune checkpoint inhibitors to reduce intestinal tumor burden by unknow(40283)
Covalent hitchhikers guide proteins to the nucleus by Alexander F. Russell & Madeline F. Currie & Champak Chatterjee(40223)
Meet the Authors: Christopher R. Mansfield and Emily R. Derbyshire by Christopher R. Mansfield & Emily R. Derbyshire(40109)
Alkaline-earth metals promote propane dehydrogenation with carbon dioxide through geometric effects: Altering the reaction pathway by unknow(32751)
Induced iron vacancies boosting FeOOH loaded on sustainable Fenton-like collagen fiber membrane for efficient removal of emerging contaminants by unknow(32534)
Efficient electric-field-assisted photochemical conversion of methane to n-propanol exclusively over penetrated TiO2Ti hollow fibers by Guanghui Feng(32468)
Bi2SiO5 nanosheets as piezo-photocatalyst for efficient degradation of 2,4-Dichlorophenol by Hangyu Shi & Yifu Li & Lishan Zhang & Guoguan Liu & Qian Zhang & Xuan Ru & Shan Zhong(32405)
A novel NDIPTA organic heterojunction photocatalyst with built-in electric field for efficient hydrogen production by Jiahui Yang & Baojun Ma & Yongfa Zhu(32379)
Enhanced conversion of methane to liquid-phase oxygenates via hollow ferrite nanotube@horseradish peroxidase based photoenzymatic catalysis by Jun Duan & Shiying Fan & Xinyong Li & Shaomin Liu(32346)
Ordered macroporous superstructure of defective carbon adorned with tiny cobalt sulfide for selective electrocatalytic hydrogenation of cinnamaldehyde by Xiao-Shi Yuan & Sheng-Hua Zhou & San-Mei Wang & Wenbo Wei & Xiaofang Li & Xin-Tao Wu & Qi-Long Zhu(32268)
What's Done in Darkness by Kayla Perrin(27162)
Topological analysis of non-conjugated ethylene oxide cored dendrimers decorated with tetraphenylethylene: Insights from degree-based descriptors using the polynomial approach by A Theertha Nair & D Antony Xavier & Annmaria Baby & S Akhila(26551)
Investigation of mechanical and self-healing properties of hydroxyl-terminated polybutadiene functionalized with 2-ureido-4-pyrimidinone by Mohsen Kazazi & Mehran Hayaty & Ali Mousaviazar(26481)